PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016494918.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 280aa    MW: 32196.5 Da    PI: 8.104
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016494918.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.83e-1665152495
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                      +++++  ++g l+lpk+fa ++g+ +++   l+++de+ rsW+++l  + +++++++++ W eF  an++k+g  ++F+++++ ++++v k
  XP_016494918.1  65 CTVKPYCVTNGFLRLPKQFAWANGLANKK-CGLIIRDERQRSWDLRL--TTYGSQVYMGGRWGEFRAANDIKVGNYIMFEVVSN-GEQPVWK 152
                     567899999**************666433.46999************..9***9**************************8875.4445555 PP

2B357.23e-18174263598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +++++ l++++l++p++fa ++g+++++  +l+++de+ rsW+++l  r  + ++ +++GW eF + n LkegD +vF+++  +++++  +++r
  XP_016494918.1 174 TIRPYCLSNDLLCIPRQFAHANGLINKK-CDLIIRDERQRSWSLRL--RSFGTGVCIKGGWHEFRDTNCLKEGDHIVFEVVT-NGEKPIWQFRR 263
                     678999****************988654.59***************..999999*************************876.56666766666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-1660153IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-1860154IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.8E-1662157IPR003340B3 DNA binding domain
CDDcd100171.80E-1162141No hitNo description
PROSITE profilePS5086311.36462156IPR003340B3 DNA binding domain
PfamPF023621.4E-1364151IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-20163264IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-21168267IPR015300DNA-binding pseudobarrel domain
CDDcd100174.53E-14169249No hitNo description
PROSITE profilePS5086312.858170264IPR003340B3 DNA binding domain
SMARTSM010195.2E-17171265IPR003340B3 DNA binding domain
PfamPF023622.4E-16174263IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MLVFRHEGNM EFDVSIFGSN HCEREYAEYL EEGEVHTVEE TSKNFEFKDA AAALHNPFGQ  60
SYFICTVKPY CVTNGFLRLP KQFAWANGLA NKKCGLIIRD ERQRSWDLRL TTYGSQVYMG  120
GRWGEFRAAN DIKVGNYIMF EVVSNGEQPV WKFHGKPNPS INSSSKAFPH FVCTIRPYCL  180
SNDLLCIPRQ FAHANGLINK KCDLIIRDER QRSWSLRLRS FGTGVCIKGG WHEFRDTNCL  240
KEGDHIVFEV VTNGEKPIWQ FRRNISGENA SISFKGLTEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016494920.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X3
RefseqXP_016494918.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X3
RefseqXP_016494917.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X2
TrEMBLA0A0V0HWG41e-112A0A0V0HWG4_SOLCH; Putative B3 domain-containing protein REM14-like (Fragment)
TrEMBLM1AKH51e-110M1AKH5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000246761e-110(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.15e-27B3 family protein